SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008932 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008932
Domain Number 1 Region: 691-837
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1017-1116
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-30
Family Ras-binding domain, RBD 0.00083
Further Details:      
 
Domain Number 3 Region: 215-372
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-22
Family Phosphotyrosine-binding domain (PTB) 0.013
Further Details:      
 
Domain Number 4 Region: 9-100
Classification Level Classification E-value
Superfamily PDZ domain-like 4.39e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000207
Family Ras-binding domain, RBD 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008932   Gene: ENSPANG00000016251   Transcript: ENSPANT00000008654
Sequence length 1430
Comment pep:known_by_projection chromosome:PapAnu2.0:1:555231:707923:-1 gene:ENSPANG00000016251 transcript:ENSPANT00000008654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRVGEASKRPLPGPAPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGIGRLESCSSDEEGGLYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASSSEPLKLKQRSLSESAAARFD
VGHESMNNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALDASILNVAMIVGYLGSIEL
PSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSS
NSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGTQPWGAPWSGPFCPDS
EGSPPFEAAHQTDRFRDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGASCGFNQRWLPV
HVLREWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFVQPPLSAPKR
EWSRKAFGMQNIFGPHRTVRKTKEDKKGSKFGRGIGLTQPSQRTSARRSFGRSKRFSITR
SLDDLESATVSDGELTGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLL
QDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRA
LPDSQQVPSSPASKHSLGSDQSSVSTPKKLSGKSKSGRSLNEEMGDEDSEKKRKGAFFSW
SRTRSTGRSQKKREHGDHADDPLHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKA
TKHCCIHLPDGTSCVVAVKAGFSIKDILSGLCERHGINGAAADLFLVGGDKPLVLHQDSS
ILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLSGLLVRLSG
EKEPLDLGAPISSLDGQRVVLEEKDPSRGKASTDKQKGVPVKQNIAVNSSSRNHSATGEE
RTLGKSNSIKIKGENGKNARDPRLSKREESIAKYQKINLDEAEVEFFELISKAQSNRADD
QRGLLRKEDLVLPEFLRLPPGSTELTLPTAAAMAKGFSKRSATGNGRESASQPSEQWEPA
QESSDSPSTSPGSGQKSPSGPFCTPQSPVSLAQEGTTQIWKRQSREVEAGGIQTVEDEHV
AELTLMGEGDISSPNSTLLPPPSGPQDVPGPSRPGSGTHGSRGLPVNRIIDVDLVTGLAP
GQDGGIAGARAGPGRAQAGGGSPTSDLPGLSPVPGEPAKPKASAHHATFV
Download sequence
Identical sequences ENSPANP00000008932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]