SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008935 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008935
Domain Number 1 Region: 382-589
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.58e-51
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 253-367
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-33
Family Kringle modules 0.00033
Further Details:      
 
Domain Number 3 Region: 89-138
Classification Level Classification E-value
Superfamily Kringle-like 1.7e-17
Family Fibronectin type II module 0.0019
Further Details:      
 
Domain Number 4 Region: 149-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.007
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008935
Domain Number - Region: 187-226
Classification Level Classification E-value
Superfamily FnI-like domain 0.000314
Family Fibronectin type I module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008935   Gene: ENSPANG00000021871   Transcript: ENSPANT00000004478
Sequence length 589
Comment pep:known_by_projection chromosome:PapAnu2.0:1:546529:553012:-1 gene:ENSPANG00000021871 transcript:ENSPANT00000004478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRWAWVSSPCPSLGLGPLLPRGSQPQPGGNRTESPEPNATVTPAILTILVTSETPATSA
PEAEGPQRGGLPPPLRAVPSSSSSQAQALTEDGRPCRFPFRYGGRMLHACTSEGSAHRKW
CATTHNYDRDRAWGYCVEATPPPGGPAALDPCASSPCLNGGSCSNTQDSQSYHCSCPRAF
TGKDCGTEKCFDETRYEYLEGGDRWARVRQGHVEQCECLGGRARCEGIRHTACLSSPCLN
GGTCHLIVATGTTVCACPPGFAGRLCNIAPDERCFLGNGTGYRGVASTSASGLGCLAWNS
DLLYQELHVDSVGTAALLGLGPHAYCRNPDSDERPWCYVVKDSALSWEYCRLEACESLTR
IQLAPDILATLPEPASPGHQSCGRRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGNSFC
AGSLVQTCWVVSAAHCFSHSPPRESVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFS
PSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSS
SLREALVPLVADHKCSNPDVYGADISPNMLCAGYFDCKSDACQGQPGTP
Download sequence
Identical sequences ENSPANP00000008935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]