SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008950 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008950
Domain Number 1 Region: 832-1036
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-52
Family Protein kinases, catalytic subunit 0.0000000223
Further Details:      
 
Domain Number 2 Region: 558-737
Classification Level Classification E-value
Superfamily Fibronectin type III 1.22e-27
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 3 Region: 445-583
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000879
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 4 Region: 353-452
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000112
Family I set domains 0.035
Further Details:      
 
Domain Number 5 Region: 134-214
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000549
Family I set domains 0.079
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008950
Domain Number - Region: 316-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000359
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 215-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0132
Family Growth factor receptor domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008950   Gene: ENSPANG00000007872   Transcript: ENSPANT00000014045
Sequence length 1064
Comment pep:known_by_projection chromosome:PapAnu2.0:1:45593964:45616987:1 gene:ENSPANG00000007872 transcript:ENSPANT00000014045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWRVPPFLLSILFLVSYVGAAVDLTLLANLRFTDPQRFFLTCVSGEAGAGRGSDAWGPP
LLLEKDDRIVRTPPGQPLRLARNGSHQVTLHRFSKPSDLVGVFSCVGGSGTRRTRVIYVH
NSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLL
QLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGHWGPDCTKECPGCLHGGVCHDH
DGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGS
QCQEACTPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASEL
EFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPDKTTAEFEVPRLVLAD
SGFWECRVSTSGGQDSRRFKVNVKVPPVPLVAPRLLTKQSRQLVVSPLVSFSGDGPISSV
RLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTT
DCPEPLLQPWLEGWHVEGPDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSP
QARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEI
QLTWQHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRVRA
SIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAAL
LTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKPQPEPLSYPVLEWEDIT
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNI
INLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFA
SDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWM
AIESLNYSVYTTKSDVRYTLLWDDLCRALRKAAPGLPHGAASKL
Download sequence
Identical sequences ENSPANP00000008950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]