SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008963 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008963
Domain Number 1 Region: 107-181
Classification Level Classification E-value
Superfamily Homeodomain-like 6.42e-24
Family Homeodomain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008963   Gene: ENSPANG00000004934   Transcript: ENSPANT00000012624
Sequence length 232
Comment pep:known_by_projection chromosome:PapAnu2.0:8:21675389:21679614:-1 gene:ENSPANG00000004934 transcript:ENSPANT00000012624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRATEPLPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRRGGHTDSPRRRDPEPEPEP
EGGRVPAGVQNDQLSPRPRAAPEEAETLAETEPERHLGSYLLDCENTSGSLPSLPQTPKQ
PQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRK
QLSSELGDLEKHSSLPALKEEAFSRASLVSLYNNYPYYPYLYCVGSWSPAFW
Download sequence
Identical sequences A0A096N8N2
ENSPANP00000008963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]