SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008971 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000008971
Domain Number - Region: 5-26
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0068
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008971   Gene: ENSPANG00000011479   Transcript: ENSPANT00000004327
Sequence length 419
Comment pep:known_by_projection chromosome:PapAnu2.0:1:160064659:160108909:-1 gene:ENSPANG00000011479 transcript:ENSPANT00000004327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNQGEDCYFFFYSTCTKGDSCPFRHCEAALGNETVCTLWQEGRCFRQVCRFRHMEIDKK
RSEIPCYWENQPTGCQKLNCAFHHNRGRYVDGLFLPPSKTVLPTVPESPEEEVKASQLSV
QQNKLSVQSNPSPQLRSVMKVESSENVPSPTHPPVVINAADDDEDDDDQFSEEGDETKTP
TLQPSPEVHNGLRVTSVRKPAVNIKQGECLNFGIKTLEEIKSKKMKEKSKKQGEGSSGVS
SLLLHPEPVPGPEKENVRTVVRTVTLSTKQGEEPLVRLSLTERLGKRKFSAGSDSDPPLK
RSLAQRLGKKVEVPETNIDKTPKKAQVSKSLKERLGMSAGPNNEDATEKVNKVGEIHVKT
LEEILLERASQKRGELQTKLKTEGPSKTDDSTSGARSSSTIRIKTFSEVLAEKKHRQQE
Download sequence
Identical sequences ENSPANP00000008971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]