SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008995 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008995
Domain Number 1 Region: 191-515
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-77
Family Protein kinases, catalytic subunit 0.00000191
Further Details:      
 
Domain Number 2 Region: 34-186
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.49e-31
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008995   Gene: ENSPANG00000026216   Transcript: ENSPANT00000023992
Sequence length 553
Comment pep:known_by_projection chromosome:PapAnu2.0:2:144249348:144288165:-1 gene:ENSPANG00000026216 transcript:ENSPANT00000023992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAEIRQKLSPNFHSLC
EQQPIGRRLFRDFLATVPTFREAATFLEDVQNWELAEDGPTKDSTLQGLVAACASGPAPG
NPHPFFSQAMATKCQAATTEEDRVAAVTLAKSEAMAFLQEQPFKDFLTSPFYDKFLQWKL
FEMQPVSDKYFTEFRVLGKGGFGEVCAVQAKNTGKMYACKKLDKKRLKKKGGEKMALLEK
EILEKVSSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHIYNVGTRGLDMSRVIFYSAQI
ACGMLHLHELGIVYRDMKPENVLLDDLGNCRLSDLGLAVQMKGDKPITQRAGTNGYMAPE
ILIEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTLQDEVKFQHDNFT
EEAKDICRLFLAKKPEQRLGSREKSDDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYA
KDIGEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCG
EGNSSKSGVCLLL
Download sequence
Identical sequences A0A096N8R4
ENSPANP00000008995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]