SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009014 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009014
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000216
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009014   Gene: ENSPANG00000009062   Transcript: ENSPANT00000020056
Sequence length 795
Comment pep:known_by_projection chromosome:PapAnu2.0:2:95200980:95389531:-1 gene:ENSPANG00000009062 transcript:ENSPANT00000020056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNN
VKSRFKRFGSAKVLKNLYRKHRLESGACFDILGGSLFESNLENEGSISGSDSTFYRQSEG
HSVMDTLAVALRVAEEAIEEAISKAEAYGDSLDKQNEASYLRDHKEELTEELATTILQKI
IRKQKSKSEQQVEEEPGWPHPQSGSTKVADEGTSASPGGHRTPAALWRSQSAFSIIGEEA
LKTPPAEAASRQPRDQGQHPRAESALPSWKSVDRLDETNLAPVLQSPDRNWVALKDGAPP
PTRLLAKPKSGTFQALEVASSVASAYDEMGSDSEEDFDWSEALSKLCPRSQGLPRNPQPQ
PTQAQSTDQGPIAASPSSAISPNPEAMCSDSETSSAGSSREVGHQARLSWLQRKAPRNPA
AEKMRLQGELDVNFNPQVTSRETSDSSEPEEAPHTTDRRARRWRRARLGSEEPSKEPSSP
SAQLRDLDTRQVSDDLSETDISNEARDPPTPINTTEEKRRNRLYELAMKMSEKETSSGED
QESEPKTESENQKESLSSEDNSQSVQDELKKKFSAVSLCNISTEVLKVINATEELIAGST
GPWESPQVPPDREKGTFPRGTDQVRLDEQLTSLEENVYLAAGTVYGLESQLTELEDAARC
IHSGTDETHLADLEDQVATAAAQVHHAELQISDIESRISALTIAGLNIAPCVRLTRRRDQ
KQRTQVQTIDTSRQQRRKLPAPPVKAEKIETSSVTTIKTFNRNFILRGSSTNRTKERKGT
TKDLMEPALESAVMY
Download sequence
Identical sequences A0A096N8T3
ENSPANP00000009014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]