SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009017 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009017
Domain Number 1 Region: 392-639
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.16e-66
Family SAICAR synthase 0.00011
Further Details:      
 
Domain Number 2 Region: 650-805
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 2.09e-39
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009017   Gene: ENSPANG00000017692   Transcript: ENSPANT00000008250
Sequence length 807
Comment pep:known_by_projection chromosome:PapAnu2.0:5:72068739:72119069:-1 gene:ENSPANG00000017692 transcript:ENSPANT00000008250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGAGKHWTEEEVKALLSVWAEKNIRKQLYGTLRNKGIFIYIAKRLQSLGVYRDWKQCR
AKYKNLKYEYRTVKYAHNSGDSSKTMKFFHDLDVILQYEPATQFTEEDANGRYLETLSPS
TAPETTEGKMSIASEDKEDVSGNPLLLVSRVRPMELGISTSVLEPSNNTTFIPTVANEGG
KHWTVTEVRALIDIWSDKSIQRQLEGTVRNKRIFEQIAAKLQKFGIERDWKQCRTKYKNL
KHEYKIVRTAQDLGMTKSMKFFTELDAILGPNKTEKSRDQESQDGEHVTECANVKMGEDQ
TELFEGHNKSQGTLSFKRKAHEDEPVSKSLKKSAPEIITNQFPQSIITEPKDSTECFCRQ
ETQLHQSSALLPGAVAVLSPLRIMATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKD
QITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIE
WVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKLCFAGLVI
GQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLW
PSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSD
LGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGP
VMSGNTAYPVISCPPLTPDWGAQDVWSSLRLPSGLGCSTILSPEGSAQFAAQIFGLNNHL
VWSKLRASILNTWISLKQADKKIRECH
Download sequence
Identical sequences ENSPANP00000009017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]