SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009029 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009029
Domain Number 1 Region: 280-528
Classification Level Classification E-value
Superfamily SIS domain 4.73e-19
Family mono-SIS domain 0.0064
Further Details:      
 
Domain Number 2 Region: 29-279
Classification Level Classification E-value
Superfamily SIS domain 0.00000000584
Family mono-SIS domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009029   Gene: ENSPANG00000015581   Transcript: ENSPANT00000007059
Sequence length 625
Comment pep:known_by_projection chromosome:PapAnu2.0:13:26530731:26553011:1 gene:ENSPANG00000015581 transcript:ENSPANT00000007059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAEEIVRLLGQCDAEI
FQEEGQALPTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKSLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISV
GLSAPFVAGQMDYCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQ
KAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFE
RAHQVTYSQSPKIATLMKSVSTSLEKKGHVYLVGWQTLGIIAIMDGVECIHTFGADFRDV
RGFLIGDHSDMFNQKAELTNQGPQFTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQ
TIVEQVKEKTSHIQALAHSTVGQTLPIPLKKLFPSIISITWPLLFFEYEGNFVQKFQREL
STKWVLNTVSTGAHVLLGKILQNHMLDLRISNSKLFWRALAMLQRFSGQSKARCIESLLR
AIHFPQPLSDDIRAAPISCHVQVAHEKEQVIPIALLSLLFRCSITEAQAHLAAAPSVCEA
VRSALAGPGQKRTADPLEILEPDGQ
Download sequence
Identical sequences A0A096N8U8
ENSPANP00000009029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]