SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009030 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009030
Domain Number 1 Region: 281-376
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 7.38e-17
Family PG130-like 0.054
Further Details:      
 
Domain Number 2 Region: 63-132
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000767
Family Calmodulin-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009030   Gene: ENSPANG00000015946   Transcript: ENSPANT00000014361
Sequence length 386
Comment pep:known_by_projection chromosome:PapAnu2.0:20:65692702:65726375:1 gene:ENSPANG00000015946 transcript:ENSPANT00000014361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVAAPAPLAPAGSPLAPRPAAGGGGGGERARVSGSGRPAPRRWPVPAVSAAAGAAGERRG
GTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLSEKELEDLFHTIDSDNTNHVDTKELC
DYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSL
LSSVESAVEAIEEQTGQLRQNHSKPSHGVAQTWYGSPTRASAPNHKLMAVEQGKSLPSAT
EDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLVRQEMAVCPEQLS
EFLDSLRPYLRGTAGARSCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQSPVCKAFRHV
KVDTLSQPEALSRISVPAVWCTVGRD
Download sequence
Identical sequences ENSPANP00000009030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]