SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009057 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009057
Domain Number 1 Region: 59-292,379-472
Classification Level Classification E-value
Superfamily TPR-like 9.7e-22
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009057
Domain Number - Region: 20-76
Classification Level Classification E-value
Superfamily TPR-like 0.000204
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009057   Gene: ENSPANG00000012072   Transcript: ENSPANT00000028120
Sequence length 871
Comment pep:known_by_projection chromosome:PapAnu2.0:17:19899979:19965119:1 gene:ENSPANG00000012072 transcript:ENSPANT00000028120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNVLLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLG
KKEEAYEFVRKGLRNDVKSHVCSWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRD
LSLLQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQTQQ
QVPPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLG
RLKEASEVFKNLIDRNAENWCYYEGLEKALQISTLEERLQIYEEISKQHPKAITPRRLPL
TLVPGERFRELMDKFLRVNFSKGCPPLFTTLKSLYYNTEKVSIIQELVTNYEASLKTCDF
FSPYEDGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAAIASTPTLIELFYMKAKIY
KHIGNLREAAKWMDEAQSLDTADRFINSKCAKYMLRANMIKEAEEMCSKFTREGTSAMEN
LNEMQCMWFQTECISAYQRLGRYGDALKKCHEVERHIFVEITDDQFDFHTYCMRKMTLRA
YVDLLRLEDILRRHAFYFKAARSAIEIYLKLYDNPLTNESKQQEINSAKMLRRELKKIVF
RDHRCFYVFSLILERLDTEKDKYVLQKNTRKPVSQRIEETSGLKEELIPEKLERVENPLE
EAVKFLIPLKNLVADNIDTHLLAFEIYFRKDTGKFLLMLQSVKRAFAINSNNPWLHECLI
RFSKSVSNHSNLPDIVSQVLSQEMQKIFVNKDLESFNEDFLKHNATSLQHLLSGAKMMYF
LDKSRQEKAITIATRLDETIKDKNVKTLIKVSEALLDGSFGNCSSQYEEYRMACHNLLPF
TSAFLPAVNEVDNPNVALNHTANYDVLANEI
Download sequence
Identical sequences ENSPANP00000009057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]