SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009099 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009099
Domain Number 1 Region: 146-273
Classification Level Classification E-value
Superfamily PUG domain-like 1.83e-30
Family PUG domain 0.003
Further Details:      
 
Domain Number 2 Region: 307-408
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.5e-17
Family UBX domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009099   Gene: ENSPANG00000014343   Transcript: ENSPANT00000027103
Sequence length 441
Comment pep:known_by_projection chromosome:PapAnu2.0:19:4246772:4258703:-1 gene:ENSPANG00000014343 transcript:ENSPANT00000027103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKFFQEFKADIKFKSAGPGQKLTESVGEKAPKQKSSQPAPRPPRQGPTNEAQMAAAAAL
ARLEQKQSRAWGPTSQDSIRNQVRKELQAEATVSGSPEAPGTNVVSEPREEGSAHLAVPG
VYFTCPLTGATLRKDQRDARIKEAILSHFSTDPVAASIMKIHTFNKDRDRVKLGVDTIAK
YLDNIHLHPEEEKYRKIKLQNKVFQERINCLEGTHEFFEAIGFQKVLLPIQDQEDPEEFY
VLSETTLAQPQSLERHKEQLLAAEPVRAKLDRQRRVFQPSPLASQFELPGDFFNLTAEEI
KREQRLRSDAVERLSVLRTKAMREKEEQRGLRKYTYTLLRVRLPDGCLLQGTFYARERLG
AVYGFVREALQSDWLPFELLASGGQKLSEDENLALNECGLVPSALLTFSWDMAVLEDIKA
AGVEPDAILKPELLSAIEKLS
Download sequence
Identical sequences F6VEF6
ENSMMUP00000021964 ENSPANP00000009099 NP_001245098.1.72884 9544.ENSMMUP00000021964 ENSMMUP00000021965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]