SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009103 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009103
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-34
Family Phosphotyrosine-binding domain (PTB) 0.0000117
Further Details:      
 
Domain Number 2 Region: 138-249
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-19
Family PDZ domain 0.00021
Further Details:      
 
Domain Number 3 Region: 242-325
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-16
Family PDZ domain 0.0000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009103   Gene: ENSPANG00000003568   Transcript: ENSPANT00000002849
Sequence length 333
Comment pep:known_by_projection chromosome:PapAnu2.0:19:3542367:3553647:-1 gene:ENSPANG00000003568 transcript:ENSPANT00000002849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAREAMDRVKAPDGETQPMTEVDLFVSTKRIKVLTADSQEAMMDHALHTISYIADIGC
VLVLMARRRLARRPAPQDHGRRLYKMLCHVFHAEDAQLIAQAIGQAFAAAYSQFLRESGI
DPSQVGAQPSPGPGHLHNGDLDHFSNSDNCREVLLEKRRGEGLGVALVESGWGSLLPTAV
IANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAAVRETKSQTSVTLSIVHCPP
VTTAIIHRPHTREQLGFCVEDGIICSLLRGGIAERGGIRVGHRIIEINGQSVVATPHARI
IELLTEAYGEVHIKTMPAATYRLLTGQEQPVYL
Download sequence
Identical sequences ENSPANP00000009103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]