SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009124 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009124
Domain Number 1 Region: 16-90
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000524
Family S100 proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009124   Gene: ENSPANG00000011814   Transcript: ENSPANT00000011110
Sequence length 103
Comment pep:known_by_projection chromosome:PapAnu2.0:1:127406543:127407514:-1 gene:ENSPANG00000011814 transcript:ENSPANT00000011110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPS
NCGLEEKIANLGSCNDSKLEFGSFWELIGEAAKSVKPERPVRG
Download sequence
Identical sequences ENSPANP00000009124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]