SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009141 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009141
Domain Number 1 Region: 242-313
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.12e-17
Family PCI domain (PINT motif) 0.0000322
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009141
Domain Number - Region: 79-161
Classification Level Classification E-value
Superfamily TPR-like 0.0284
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009141   Gene: ENSPANG00000021637   Transcript: ENSPANT00000027473
Sequence length 354
Comment pep:known_by_projection chromosome:PapAnu2.0:5:45838327:45863730:-1 gene:ENSPANG00000021637 transcript:ENSPANT00000027473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNENVSLVISRQLLTDFCTHLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLAS
IYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRAS
LLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEALKHALHC
TILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKAT
TADGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFI
DQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ
Download sequence
Identical sequences ENSPANP00000009141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]