SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009215 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009215
Domain Number 1 Region: 54-128
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.7e-21
Family Ribosomal protein S18 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009215   Gene: ENSPANG00000018281   Transcript: ENSPANT00000000842
Sequence length 144
Comment pep:known_by_projection chromosome:PapAnu2.0:7:1706814:1707245:-1 gene:ENSPANG00000018281 transcript:ENSPANT00000000842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIVAVCSGLGRKKLTHLVMAAVSLTHPRTHVVLWRRGCSQYKQISTNEDLSIPMENSY
KEALKKCILCGKHVDFKNVQLLSQFISPFIGCICGRHKTGLCGKKQKEITKAIKRPQIIG
LMPVTYKDAAYLKDPKVCNIRYQE
Download sequence
Identical sequences A0A1D5R2W4
XP_011769796.1.29376 ENSPANP00000009215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]