SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009221 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009221
Domain Number 1 Region: 1050-1201
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.35e-24
Family DnaQ-like 3'-5' exonuclease 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009221   Gene: ENSPANG00000000440   Transcript: ENSPANT00000003148
Sequence length 1210
Comment pep:known_by_projection chromosome:PapAnu2.0:19:1586412:1619386:-1 gene:ENSPANG00000000440 transcript:ENSPANT00000003148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSTGFFRAIDCPYWSGAPGGPCRRPYCHFRHRGARVPGAPGDGGEAPPAAGLGYDPYN
PELPKPPSQRENGTLGLGEEPRPDVLELELVNQAIEAVRSEVELEQRRYRELLETAREHR
AAEAPALAPRGPNASPTVGLDEDAFPLAFDYSPSSHGLLSPDTGYQPTPLATPAESGSKY
LLASLDRGQGRGGGGGGALEYVPKAVSQPRRHSRPVPSGKYVVDNSRPPTDLEYDPLSNY
SARHLSRASSRDERAAKRPRGPRSSEPHTPAPKKPCDPFSSCDARFSDSEDEATTAPGNE
PTIASTPKARADPESKATGQPPSKEGLEAEGGGLRETKETAVQCDVGDFQPPPAKSCSPA
QVQASQDGGCPKEGKPKKKKSGTPPAPSCKDGTQRKDKTKDKGRGRPAEKPRADKKGPQA
SSPRRKAERLEGTKKKPSSATPVASSGKGRPDRPARRPSPTSGDSQQAASRGPPRPLQLP
DRKSTKVPSGKLVERKARSLDEGASQDAPKLKKRALSHADLFGDESEDEAAGPGVPSVWP
PALPSLSSDSDSDSDSSLGFPEARGPPKRLKAAPSSSSSSSSAGADVDYSALEKEVDFDS
DPMEECLRIFNESTSVKAEDRGRLARQPPKEEKSEEKGLSGLTTLFPGQKRRISHLSKQG
QEAEPPRRSPAVPPARPPTAQEVCYLRAQQAQRASASLLQAPTRLAEKLPSVHISAPGEK
RRIAHIPNPRLAAAPTGAKRTLSASGSQPSNGPEPGGQQLKTRTLSGMASKTTTTITPKR
IAHSPSLQSLKKPIIPKEFGGKVPTVIRQRYLNLFIEECLKFCTSNQEAIEKALNEEKVA
YDRSPSKNIYLNVAVNTLKKLRGLAPSAVPSLSKTSGRRVVSHEVVLGGRLATKTSFSLS
RPSSPRVEDLKGAALYSRLKEYLLTQDQLKENGYPFPHPERPGGAIIFTAEEKRPKDSSC
RTCCRCGTEYLVSSSGRCVRDEECYYHWGRLRRNRVAGGWETQYMCCSAAAGSVGCQVAK
QHVQDGRKERLEGFVKTFEKELPGDTHPGIYALDCEMSYTTYGLELTRVTVVDTDVHVYD
TFVKPDNEIVDYNTRFSGVTEADLADTSVTLRDVQAVLLSMFSADTILIGHSLESDLLAL
KVIHSTVVDTSVLFPHRLGLPYKRSLRNLMADYLRQIIQDNVDGHSSSEDAGACMHLVIW
KVREDAKTKR
Download sequence
Identical sequences ENSPANP00000009221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]