SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009223 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009223
Domain Number 1 Region: 38-178
Classification Level Classification E-value
Superfamily Cupredoxins 5.35e-47
Family Ephrin ectodomain 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009223   Gene: ENSPANG00000018290   Transcript: ENSPANT00000020887
Sequence length 216
Comment pep:known_by_projection chromosome:PapAnu2.0:19:1025650:1041927:1 gene:ENSPANG00000018290 transcript:ENSPANT00000020887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAALPALGRDKGRSPGPSPAGAAAAARAPTVRAANSDRYAVYWNRSNPRFHAGEGDDGG
GYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRP
AAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETL
YEPPEPIFTSNNSCSSLGGCRLFLSTIPLLWTLLGS
Download sequence
Identical sequences ENSPANP00000009223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]