SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009269 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009269
Domain Number 1 Region: 942-1274
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.13e-60
Family Ankyrin repeat 0.0000517
Further Details:      
 
Domain Number 2 Region: 1293-1427
Classification Level Classification E-value
Superfamily TPR-like 1.16e-22
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009269
Domain Number - Region: 362-445,559-622
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000164
Family Extended AAA-ATPase domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009269   Gene: ENSPANG00000008396   Transcript: ENSPANT00000016733
Sequence length 1862
Comment pep:known_by_projection chromosome:PapAnu2.0:12:20958138:21089760:1 gene:ENSPANG00000008396 transcript:ENSPANT00000016733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLRLFLLERSSGGPGVLEGLGGDFGPETSPVLPLDHGADSPVSSLPAAEDTYRVSLAKGV
SMSLPSSPLLPRQSHLVQSRANKKSPGPVRKPKYVESPRVPGDAVIMPFREVSKPTEPDE
HEAKADNEPSCSPAAQELLTRLGFLLGEGIPSATHITIEDKNETMCTALSQGISPCSTLT
SSTASPSTDSPCSTLNSCVSKTAANKSPCETISSPSSTLESKDSGIIATITSSSENDDRS
GSSLEWNKDGSLRLGVQKGVLHDRRADNCSPVAEEETTGSAESTLPKAESSAGDGPVPYS
QGSSSLIMPRPNSVAATSSTKLEDLSYLDGQRNAPLRTSIRLPWHNTAGGRAQEVKARFA
PYKPQDILLKPLLFEVPSITTDSVFVGRDWLFHQIEENLRNTELAENRGAVVVGNVGFGK
TAIISKLVALSCHGSRMRQIASNSPSSSPKTSDPTQDLPFTPLLSPSSSTSASSTAKTPL
GSVSAENQRPREDAVKYLASKVVAYHYCQADNTYTCLVPEFVHSIAALLCRSHQLAAYRD
LLIKEPQLQSMLSLRSCVQDPVAAFKRGVLEPLTNLRNEQKIPEEEYIILIDGLNEAEFH
KPDYGDTLSSFITKIISKFPAWLKLIVTVRANFQEIISALPFVKLSLDDFPDNKDIHSDL
HAYVQHRVHSSQDILSNISLNGKADATLIGKVSSHLVLRSLGSYLYLKLTLDLFQRGHLV
IKSASYKVVPVSLSELYLLQCNMKFMTQSAFERALPILNVALASLHPMTDEQIFQAINAG
HIQGEQGWEDFQQRMDALSCFLIKRRDKTRMFCHPSFREWLVWRADGENTAFLCEPRNGH
ALLAFMFSRQEGKLNRQQTMELGHHILKAHIFKGLSKKTGISSSHLQALWIGYSTEGLSA
ALASLRNLYTPNVKVSRLLILGGANVNYRTEVLSSSYPILCPFKTVSYTSYSRVVKELSA
LIGKTSQNVNPMYAYREWGLHTVRLITAMGASCPQVDHLDKKGQCALVHSALRGHGDILQ
YLLTCEWSPGPPQPGALRKNHALQQALTAAASMGHSSVVQCLLEMEKEHEVEVNGTDTLW
GETALTAAAGRGKLEVCELLLGRGAAVSRTNRRGVPPLFCAARQGHWQIVRLLLERGCDV
NLSDKQGRTPLMVAACEGHLSTVEFLLSKGAALSSLDKEGLSALSWACLKGHRAVVQYLV
EEGAAIDQMDKNGRTPLDLAAFYGDAETVLYLVEKGAVIEHVDHSGMRPLDRAIGCRNTS
VVVALLRKGAKLGNAAWAMATSKPDILIILLQKLMEEGNVMYKKGKMKEAAQRYQYALRK
FPREGFGEDMRPFNELRVSLYLNLSRCRRKTNDFGMAEEFASKALEMKPKSYEAFYARAR
AKRNSRQFVAALADLQEAVKLCPTNQEIKRLLARVEEECKQLQRSQQQKQQGLPPAPPND
SENEEDAPTPGLSDHFHPEETEEEETSPQEESVSPTPRSQPSSSVPSPYIRNLQEGLQSK
GRPVSPQSRAGIGKPLREPVAQPGLVLQPSKQAQIVKTSQHLGSGQSALRNGSTKVQISS
QNPPPSPMPGRIAATPAGSRTQHLEGTGTFTTGAGCGHFGDRLGPSQNVRLQRGESGSAH
PLPNKTKTTERLLSHSSMPVEAAPPNQGGLATSSDMRHPASLTSSGSSGSPSSSIKMSSS
TSSLTSSSSFSDGFKVQGPDTRIKDKVVTHVQGGTAEHRPRNTPFMGIMDKTARFQQQSN
PPSRAWHCPAPERLLANTSAAGLQSAATEKPSLVQVGGCNNQAKTCSVSTLSASVHNGAQ
VKELEENKCQIPVHCQENRITKTVSHLYQESISKQQPHISNEAHRSHLTAAKPKRSFIES
NV
Download sequence
Identical sequences ENSPANP00000009269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]