SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009275 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000009275
Domain Number - Region: 99-187
Classification Level Classification E-value
Superfamily t-snare proteins 0.0439
Family t-snare proteins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009275   Gene: ENSPANG00000018280   Transcript: ENSPANT00000026120
Sequence length 212
Comment pep:known_by_projection chromosome:PapAnu2.0:14:3643547:3644185:-1 gene:ENSPANG00000018280 transcript:ENSPANT00000026120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMTMEEMKNEAETTSMVSTPLSAVMYPVFKELERVNLSAAQTLRAAFIKTEKENPGLTQ
DIIMKILEKKSVEVNFMESLLCMAADDIEEYMIEWPEPEFQDLNEKARALKQILSKIPDE
INDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEYKKKELVKYSKSFSDTLKM
YFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Download sequence
Identical sequences ENSPANP00000009275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]