SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009312 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009312
Domain Number 1 Region: 518-649
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.91e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 1154-1216
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.46e-17
Family TB module/8-cys domain 0.00019
Further Details:      
 
Domain Number 3 Region: 641-774
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-16
Family Growth factor receptor domain 0.0044
Further Details:      
 
Domain Number 4 Region: 1318-1381
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 5 Region: 858-981
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 395-444
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000249
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 7 Region: 775-901
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 8 Region: 1511-1593
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000157
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 9 Region: 1024-1079
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000077
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 332-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000932
Family EGF-type module 0.009
Further Details:      
 
Domain Number 11 Region: 265-330
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000131
Family TB module/8-cys domain 0.0028
Further Details:      
 
Domain Number 12 Region: 1261-1311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000031
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 1226-1275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000331
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 156-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000373
Family EGF-type module 0.033
Further Details:      
 
Domain Number 15 Region: 979-1031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000384
Family EGF-type module 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009312
Domain Number - Region: 1071-1097
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00724
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009312   Gene: ENSPANG00000000994   Transcript: ENSPANT00000003200
Sequence length 1598
Comment pep:known_by_projection chromosome:PapAnu2.0:19:34894390:34931687:1 gene:ENSPANG00000000994 transcript:ENSPANT00000003200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPGTSGRRPLLLVLLLPLFAAAASAASPSPSLSQVVEVAGVPSRQASVAACRCCPGQT
SRRSRCIRASCRVQNCQPKKCAGPQRCLNPVPAVPSPSPSVRKRQVSLNWQPLTLQEARA
LLKRRRPRGPGGRGLLRRRPPQRAPAGKAPVLCPLICHNGGVCVKPDRCLCPPDFAGKFC
QLHSSGARPPAPAIPGLTRSVYTMPLANHRDDEHGVASMVSVHVEHPQEASVVVHQVERV
SGPAPYTVLAQSAPREDGYSDASGFGYCFRELRGGECASPLPGLRTQEVCCRGAGLAWGV
HDCQLCSERLGNSGRLGAPDGPCPTGFERVNGSCEDVDECATGGRCQHGECANTRGGYTC
VCPDGFLLDSSRSSCICEPPAGRTLPLSGILKPSNPLLPLETRLSXCCSRVGKAWGRGCQ
LCPPFGSEGFREICPAGPGYHYSASDLRYNTRPLGQEPPRVSLSQPRTLPATSRPSAGFL
PTHRPESRPDPRPGPELPLPSIPAWTGPEIPDSGPSSGMCQRNPQVCGPGRCISRPSGYT
CACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCVCGPGFRAGPRAAECLD
VDECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACEN
LPGSFRCVCPAGFRGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAP
CQDVDECARSPPPCTYGRCENTEGSFQCVCPTGFQPNAAGSECHPLPCPLDVDECENHLA
CPGQECVNSPGSFQCRPCPPGHHLHRGRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCA
PGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDE
CSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLDVDECRERGPALCGSQRCENSPG
SYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICGAQRCENTPGSYRCTPACDPGYQPTP
GGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCG
AALCENVEGSFLCVCPNSPEEFDPMTGRCVSPRTSAGTFPGSQPQAPASPVLPARPPPPR
RPSTPRQGPVGSGRRECYFDTAAPDACDNILARNVTWQECCCTVGEGWGNGCRIQQCPGT
ETAEYQSLCPHGRGYLAPSGDPSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYY
YHTQRLECIDNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSQRRCVSNESQSLDD
NLGVCWQEVGADLVCSHPRLDRQATYTECCCLYGEAWGMDCALCPAQDSDDFEALCNVLR
PPAYSPPRPGGFGLPYEYGPDLGPPYQGLPYGPELYPPPALPYDPYPPPPGPFARREAPY
GAPRFDMPDFEDDGGPYGESEAPAPPGPGTRWPYRSRDTRRSFPEPEELPEGGSYAGSLA
EPYEELEAEECGILDGCTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASP
LCVNARCLNTDGSFRCICRQGFAPTHQPHHCAPARPRA
Download sequence
Identical sequences ENSPANP00000009312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]