SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009329 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009329
Domain Number 1 Region: 32-309
Classification Level Classification E-value
Superfamily L domain-like 2.04e-52
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 407-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000958
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 449-538
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000011
Family Fibronectin type III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009329   Gene: ENSPANG00000009507   Transcript: ENSPANT00000014153
Sequence length 673
Comment pep:known_by_projection chromosome:PapAnu2.0:20:4208716:4210737:1 gene:ENSPANG00000009507 transcript:ENSPANT00000014153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSRVPLLLPLLLLLALRPGVQGCPSGCQCSQPQTVFCTARQGTTVPRDVPPNTVGLYVF
ENGITTLDTGSFAGLPSLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETF
HGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNS
LLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRG
LTRLRLAGNTRIAQLRPEDLAGLAALQELDLSNLSLQALPTDLSGLFPRLRLLAAARNPF
NCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGCPATTTTAAVPT
TRPMVREPTPLSSSLAPTWLSPTEPATEAPSLPSTAPPTIGPVPQPQDCPPSTCLNGGTC
HLEARHHLACLCPEGFTGLYCESQMGQGTQPSPTPATPRPPRPLTLGIEPVSPTSLRVGL
QRYLQGSSVQLRSLRLTYRNLSGPDKRLVTLRLPASLTEYTVTQLRPNATYSICVMPLGP
GRVPEGDEACGEARTPPAVHSNHAPVTQAREGNLPLLIAPALAAVFLAALAAVGAAYCVR
RGRAVAAAAQDKGQVGPGAGPLELEGVKAPLEPGPKATEGGGEALPSGSECEVPLMGFPG
PGLQSPLHAKPYI
Download sequence
Identical sequences A0A096N9K5
ENSPANP00000009329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]