SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009330 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009330
Domain Number 1 Region: 76-232
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-19
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 2 Region: 456-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000134
Family EGF-type module 0.0004
Further Details:      
 
Domain Number 3 Region: 298-420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000148
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 416-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000116
Family EGF-type module 0.00019
Further Details:      
 
Domain Number 5 Region: 492-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009330   Gene: ENSPANG00000024414   Transcript: ENSPANT00000014137
Sequence length 626
Comment pep:known_by_projection chromosome:PapAnu2.0:10:55747714:55749594:-1 gene:ENSPANG00000024414 transcript:ENSPANT00000014137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAASQGLRAAARSVWAGMDRSGCRHPRPALLCSGTAQSQCQRFPRRLHAVRLGNMLGV
LLLGVLTLAGPGFPAPVEPQPGGSQCVEHDCFALYPGPATFLDASQICNRLRGHLMTVRS
SVAADVISLLLSGDRGVSRRLWIGLQLPPVCGDPKPLGPLRGFQWVTGDNNTSYSRWARL
DLNGAPLCGPLCVAVSAAGATAPGEPVWEEQQCDVKADGFLCEFYFPVTCRPLAVEPGAA
TAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLELMCAAPPKAVQGHWAREAPGAWDC
SVENGGCEHACNTIAGAPRCLCPAGAALQADGRSCTHSCNDLCEHFCVPNPDKPDSYSCM
CETGYRLAADQHRCEDVDDCLLVPSPCPQRCVNTQGGFECHCKPGYDLVDGECVEPVDPC
FRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPNTRGNCECPD
GYILDDGFMCSDIDECENGGYCSGVCRNLPGTFECICGPDSARVRLIGKDCDSAEVDGGD
DGSGEPPPGPTPGCTSSPPAVGRVHSGVLIGISIASLCLVVALLALLCHLRKKQGAARAK
MEYKCAAPSKEVVLQPVRTERKPQRL
Download sequence
Identical sequences ENSPANP00000009330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]