SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009334 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009334
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily EF-hand 1.91e-48
Family Calmodulin-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009334   Gene: ENSPANG00000010830   Transcript: ENSPANT00000004719
Sequence length 146
Comment pep:known_by_projection chromosome:PapAnu2.0:9:5691117:5691557:-1 gene:ENSPANG00000010830 transcript:ENSPANT00000004719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGELTPEEEAEYKSAFSAVDTNGSGTINAQELGAALKAMGKNLSEAQLQNLISQVDSDG
DGEISFEEFMAAVKKTRAGREDLQVAFRAFDQDGDGHITVDELKQAMAGLGQPLPQEELD
AMIREADVDQDGRVNYEEFARMLTQK
Download sequence
Identical sequences ENSPANP00000009334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]