SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009338 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009338
Domain Number 1 Region: 56-100,130-221
Classification Level Classification E-value
Superfamily TPR-like 5.15e-22
Family Tetratricopeptide repeat (TPR) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009338   Gene: ENSPANG00000026428   Transcript: ENSPANT00000010716
Sequence length 239
Comment pep:known_by_projection chromosome:PapAnu2.0:19:34494987:34497799:-1 gene:ENSPANG00000026428 transcript:ENSPANT00000010716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRGALSPVLMLSAAPEPPPRPPPAISPPGPGPGSGSRHGSARPGPTPEPSGSLGAALDS
SLRAAVAFKAEGQRCYREKKFREAIGKYHRALLQLKAAQGARPGGLPAPAPGPTSSPGPA
RLSEEQRRLVESTEVECYDSLTACLLQSELVNYERVREYCLKVLEKQQGNFKATYRAGIA
FYHLGDYARALRYLQEARSREPTDTNVLRYIQLTQLKMNRCSLQREDSGAGAQTRDVIG
Download sequence
Identical sequences A0A0A0MWE5 A0A2K6DJ96 A0A2K6PQE0 I2CYH7 I7GK98
NP_001270145.1.63531 XP_010379173.1.97406 XP_011763068.1.29376 XP_011942091.1.92194 ENSPANP00000009338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]