SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009347 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009347
Domain Number 1 Region: 271-453
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-26
Family SPRY domain 0.017
Further Details:      
 
Domain Number 2 Region: 481-651
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000136
Family Nucleotide and nucleoside kinases 0.02
Further Details:      
 
Domain Number 3 Region: 7-45
Classification Level Classification E-value
Superfamily SAP domain 0.00000000641
Family SAP domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009347   Gene: ENSPANG00000011643   Transcript: ENSPANT00000009320
Sequence length 812
Comment pep:known_by_projection chromosome:PapAnu2.0:1:204279999:204289899:1 gene:ENSPANG00000011643 transcript:ENSPANT00000009320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSL
DLGGDSAGRSGAGLEQEAAVGGISALDGDQMELGEENGAAGAADSGPMEEEEAASEDENG
DDQGFQEGEDELGDEEEGAGDENGHGEQQPQPPATQQQQTQQQRGAAKEAAGKSSGPTSL
FAVTVAPPGARQGQQQAGGKKKAEGGGGGGRPGAPAAGDGKTEQKGGDKKRGVKRPREDH
GRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISRDRLSASSLTM
ESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLG
EEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKNGQDLGIAFK
ISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKGPEE
KKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLN
TLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDY
KQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEES
KKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRR
GNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNR
GYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY
Download sequence
Identical sequences ENSPANP00000009347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]