SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009399 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009399
Domain Number 1 Region: 10-107
Classification Level Classification E-value
Superfamily t-snare proteins 3.73e-28
Family t-snare proteins 0.00000268
Further Details:      
 
Domain Number 2 Region: 159-226
Classification Level Classification E-value
Superfamily SNARE fusion complex 6.8e-16
Family SNARE fusion complex 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009399   Gene: ENSPANG00000004517   Transcript: ENSPANT00000004208
Sequence length 256
Comment pep:known_by_projection chromosome:PapAnu2.0:1:183319108:183348697:1 gene:ENSPANG00000004517 transcript:ENSPANT00000004208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSSEYKLLILSKEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWD
LEDLDETINILEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNR
QALLGDSGSQNWSTGTAEKYGRLDRELQRANSHFIEEQQAQQQQLIVEQQDEQLELVSGS
IGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIA
ILFAVLLVVLILFLVL
Download sequence
Identical sequences ENSPANP00000009399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]