SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009411 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009411
Domain Number 1 Region: 360-632
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.54e-60
Family Tandem AAA-ATPase domain 0.0000228
Further Details:      
 
Domain Number 2 Region: 76-328
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.1e-56
Family Tandem AAA-ATPase domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009411
Domain Number - Region: 1200-1251
Classification Level Classification E-value
Superfamily TPR-like 0.00325
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009411   Gene: ENSPANG00000011598   Transcript: ENSPANT00000018237
Sequence length 1252
Comment pep:known_by_projection chromosome:PapAnu2.0:X:63591246:63635502:-1 gene:ENSPANG00000011598 transcript:ENSPANT00000018237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASRRFPEAEALSPEQAAHYLRYVKEAKEATKNGDLEEAFKLFNLAKDIFPNEKVLSRI
QKIQEALEELAEQGDDEFTDVCNSGLLLYRELHDQLFEHQKEGIAFLYRLYRDGRKGGIL
ADDMGLGKTVQIIAFLSGMFDASLVNHVLLIMPTNLINTWVKEFIKWTPGMRVKTFHGPS
KDERTRNLNRIQQRNGVIITTYQMLINNWQQLSSFRGQEFVWDYVILDEAHKIKTSSTKS
AICARAIPASNRLLLTGTPIQNNLQELWSLFDFACQGSLLGTLKTFKMEYENPITRAREK
DATPGEKALGFKISENLMAIIKPYFLRRTKEDVQKKKSSNPEVRLNEKNPDVDAICEMPS
LSRKNDLIIWIRLVPLQEEIYRKFVSLDHIKELLMETRSPLAELGVLKKLCDHPRLLSAR
ACCLLNLGTFSAQDGNEGEDSPDVDHIDQITDNTLMEESGKMIFLMDLLKRLRDEGHQTL
VFSQSRQILNIIERLLKNRHFKTLRIDGTITHLLEREKRINLFQQNKDYSVFLLTTQVGG
VGLTLTAATRVVIFDPSWNPATDAQAVDRVYRIGQKQNVVVYRLITCGTVEEKIYRRQVF
KDSLIRQTTGEKKNPFRYFSKQELRELFTIEDLQNSVTQLQLQSLHAAQRKSDTKLDEHI
AYLQSLGIAGISDHDLMYTCDLSIKEELDVVEESHYIQQRVQKAQFLVEFESQNKELLME
QQRNRNEGAWLREPVFPSSTKKKCPKLNKPQPQPSPLISTRHTQEEDISSKMASVVIDDL
PEEGEKQDLSSIKVNVTTLQDGRHPYEGTCSADSIATLPKGFGSVEELCTNSSLGMEKSF
ATKNEAVQKETLQEGPKQEALQEDPLESFNYVLSKSTKADLGPNLDQLKDDEILHHCNPW
PIISITNESQNAESNVSIIEIADDLSASHSALQDAQASEAKLEEERLASSPQYACDFNLF
LEDSADNRQNFSGQSLEHVEKEKSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVK
AKIRSKARRIVSDGEDEDDSFKDTSSTNPFNTSLFQFSSVKQFDASTPKNDISPPGRFFS
SQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDMEERLDDSSEAKGAEDYPEEGAEESSG
EASKYTEEDPSGETLSSENKSSWLTTSKPSALAQETSLGAPEPLSGEQLVGSPQAAEATN
DYETLVKRGKELKECGKIQEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN
Download sequence
Identical sequences A0A096N9S8
ENSPANP00000009411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]