SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009417 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009417
Domain Number 1 Region: 201-585
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.9e-163
Family Myotubularin-like phosphatases 0.00000000000052
Further Details:      
 
Domain Number 2 Region: 75-198
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-44
Family GRAM domain 0.000000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009417   Gene: ENSPANG00000012250   Transcript: ENSPANT00000026032
Sequence length 643
Comment pep:known_by_projection chromosome:PapAnu2.0:14:85585122:85670631:-1 gene:ENSPANG00000012250 transcript:ENSPANT00000026032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSSSCESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPD
LRVLRESNKLAEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERD
PPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRSLRFAHKPEGRTRRSIFENLM
KYAFPVSNNLPLFAFEYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTY
PALLVVPANIPDEELKRVGSFRSRGRIPVLSWIHPESQATVTRCSQPMVGVSGKRSKEDE
KYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMR
ESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDG
WDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVF
LQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSL
WSYINSQAEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKEL
LAKRAELQKKVEELQREISNRSTSSSERASSPAQCVTPVQTVV
Download sequence
Identical sequences A0A096N9T1 A0A2K5LV85 A0A2K6E3F5 F6W5A0 G7PNI5
ENSMMUP00000019430 NP_001244823.1.72884 XP_005579461.1.63531 XP_011744124.1.29376 XP_011927414.1.92194 9544.ENSMMUP00000019430 ENSMMUP00000019430 ENSPANP00000009417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]