SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009464 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009464
Domain Number 1 Region: 69-150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.66e-26
Family Cold shock DNA-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009464   Gene: ENSPANG00000004547   Transcript: ENSPANT00000005531
Sequence length 157
Comment pep:novel chromosome:PapAnu2.0:16:32013495:32013968:-1 gene:ENSPANG00000004547 transcript:ENSPANT00000005531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIQTERAYQKQPTIFQNKKRVLLGETGKKLPWYYKNIGLGFKTPKEAIEGTYIDKKCP
FTGNVSIEGRILSGVVTKMKMRGTIVIRRDYLHYIRKYNHFEKRHKNMSVHLSPCFRDVQ
IGDIVTVDKCRPLSKTVHFNVFKVTKAAGTKKQFQKF
Download sequence
Identical sequences A0A096N9X3
ENSPANP00000009464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]