SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009513 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009513
Domain Number 1 Region: 10-71
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000183
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009513   Gene: ENSPANG00000010826   Transcript: ENSPANT00000004572
Sequence length 220
Comment pep:known_by_projection chromosome:PapAnu2.0:16:8055742:8056401:-1 gene:ENSPANG00000010826 transcript:ENSPANT00000004572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGESKDSSGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRTLV
CPICRYVTFLSKKSSRWPSMLDKSSQTLTVPVALPSVPPLDSLGHTNPLAASSSAWRPPP
GQARSPGSPGQSAQLPLDLLPSLPRESQVFVISRHGMPLGEQDSVLPRRSLAELSEASPA
PRSARAFCCRSRALLLITLIAVVAVVAAILPWVLLVRKQA
Download sequence
Identical sequences A0A096NA19 A0A2K5L103 A0A2K5XS44 A0A2K6AQU1
ENSPANP00000009513 XP_011726698.1.29376 XP_011726707.1.29376 XP_011849878.1.47321 XP_011906891.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]