SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009536 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009536
Domain Number 1 Region: 78-192
Classification Level Classification E-value
Superfamily TPR-like 3.8e-24
Family Tetratricopeptide repeat (TPR) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009536   Gene: ENSPANG00000014461   Transcript: ENSPANT00000009229
Sequence length 387
Comment pep:known_by_projection chromosome:PapAnu2.0:1:56924811:56958296:1 gene:ENSPANG00000014461 transcript:ENSPANT00000009229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEEEFEKVPLFMKRAPSEIDPRENPD
LACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADPDLNAVLY
TNRAAAQYYLGNFRSALNDVTAARKLKPCHLKAIIRGALCHLELKHFAEAVNWCDEGLQI
DGKEKKLLELRAKADKLKRIEQRDVRKASLKEKKERNQNEALLQAIKARNIRLSEAACED
EDSPSEGLGELFLDGLSSENPHGARLSLDDQGRLSWPVLFLYPEYAQSDFISAFHEDSRF
IDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRVPAKSTLLQVLQHHRYFVKAL
TPAFLVCVGSSPFCKNYLRGRKVYQIR
Download sequence
Identical sequences A0A096NA39
ENSPANP00000009536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]