SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009541 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009541
Domain Number 1 Region: 120-621
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.48e-158
Family Calponin-homology domain, CH-domain 0.00000000282
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily EF-hand 5.87e-20
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009541   Gene: ENSPANG00000002797   Transcript: ENSPANT00000013644
Sequence length 629
Comment pep:known_by_projection chromosome:PapAnu2.0:2:143407608:143516198:-1 gene:ENSPANG00000002797 transcript:ENSPANT00000013644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKII
SVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSY
SEEEKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDER
AINKKKLTPFTVSENLNLALNSASAIGCTVVNIGASDLKEGKPHLVLGLLWQIIKVGLFA
DIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLTNAGWHTISNFSQDIKDSRA
YFHLLNQIAPKGGEDGPAIAIDLSGINETNDLKRAGLMLQEADKLGCKQFVTPADVVSGN
PKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSD
LTDALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIA
GQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSIS
SFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYA
LPDDLVEVKPKMVMTVFACLMGKGLNRIK
Download sequence
Identical sequences A0A096NA44 A0A2K5MAY2 A0A2K5XKC6 F7EA87 G7P009
ENSPANP00000009541 9544.ENSMMUP00000016286 ENSMMUP00000016286 ENSMMUP00000016286 XP_005546053.1.63531 XP_005546054.1.63531 XP_011856647.1.47321 XP_011856655.1.47321 XP_011916595.1.92194 XP_011916596.1.92194 XP_011916598.1.92194 XP_011916599.1.92194 XP_011916600.1.92194 XP_011916601.1.92194 XP_011916602.1.92194 XP_014987474.1.72884 XP_014987475.1.72884 XP_014987476.1.72884 XP_015300669.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]