SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009566 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009566
Domain Number 1 Region: 223-384,437-463,580-753
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.61e-34
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 670-901
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.93e-17
Family WD40-repeat 0.016
Further Details:      
 
Domain Number 3 Region: 958-1074
Classification Level Classification E-value
Superfamily EF-hand 0.0000000286
Family Calmodulin-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009566   Gene: ENSPANG00000010983   Transcript: ENSPANT00000006019
Sequence length 1128
Comment pep:known_by_projection chromosome:PapAnu2.0:11:121229334:121307454:1 gene:ENSPANG00000010983 transcript:ENSPANT00000006019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDAEEAPGEATGENGETEMKEEEEPNPNYKEVENLQQESKDDTLDKKIVMEETEEVAGE
AQEKEASGIQEETTVEPQEVTESMIHLETQITDSQSITSGIFPKAQRGSKSKPSLQLEDA
ETDELLQGLSTQLEFLDLDQISPEEQQISSPERQPSGELEEKTDWMLQDELGRERRDLEP
ENREEGQESRVSNIQSEAGISRESLVSSTTEDILFERDESAPVYPLTMTWSFGWNSSLPV
YYIREEKQRVLLYVCAHTAIIYNVLRNNQHHLQGHANIISCLCVSEDRRWIATADKGPDC
LVIIWDSFTGIPVHTIFDSCPEGNGIRAMAMTRDAKYLATISDAEVQKVCIWKWTLAVET
PACTLELPKEYGVQNYLTFNPTNNKELVSNSKTQAIYYAWYEERDTLAHSAPLLTEKTFN
KLVGKFSQSIFHLNLTQILSATMEGKLVVWDIHRPPSSASTFLGFPYIKPCKLVHLQKEG
ITKPHLTTLHIYIVTGDIKGNIKFYDHTLSIVNWYSHLKLGAIRTLSFSKTPATPPTEKS
NYPPDCTLKGDLFVVRNFIIGTSDAAVYHLTTDGTKLEKLFVEPKDAICAISCHPYQPLI
AIGSICGMIKVWNYENKQYLFSRVFEKGLGVQSLTYNPEGALLGAGFTEGTVYILDAMSL
ENESPEPFKYSRTSVTHISFSHDSQYMATADRSFTVAVYMLLVRNGQRVWEYLARLRSHR
KSIRSLLFGVYLDSNEPRLLSLGTDRLLIEYDLLRSYKDCLEVLDIHHTDQGCYPTCMVW
YPPLTRELFLLICNSGYKVKLFNSTTKMCRKTLMGPAYGSPIEQTQVLPVRSMAELQKRY
LVFINRDKVGLQILPVDGNPHKTSAIVCHPNGVAGMAISYDGRYAFTAGGHDRSVVQWKI
TLSVLEAAVSLGGEDLTPFYGLLSGGREGKFYRELEDYFYYSQLRSQGIDTMETRKVSEY
ICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGKLIDKINLPDFLKVYLNHKPPF
GNTMSGIHKSFEVLGYTNSKGKKAIRREDFLRLLVTKGEHMTEEEMLDCFASLLGLNPEG
WKSEPATSSVKGSEICLEEELPDEITAEIFATEILGLTISEDSGQDGQ
Download sequence
Identical sequences ENSPANP00000009566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]