SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009592 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009592
Domain Number 1 Region: 31-185,213-337
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.77e-64
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 500-694
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.000077
Further Details:      
 
Domain Number 3 Region: 742-806
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-16
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009592   Gene: ENSPANG00000008856   Transcript: ENSPANT00000012626
Sequence length 990
Comment pep:known_by_projection chromosome:PapAnu2.0:2:50940394:51201975:1 gene:ENSPANG00000008856 transcript:ENSPANT00000012626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQTKFKKDKEIIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIE
LEYSRSLEKLAERFSSKIRSSREHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIF
MNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESK
LKEAEKQEEKQFNKSGDLSMNLLRHEDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKAR
NDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLD
VIENAVDNLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQVSAQQPVQTELLMRYH
QLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYM
SKINIAKRRANQQETEMFYFTKFKEYVNGSNLITKLQAKHDLLKQTLGEGERAECGTTRP
PCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVVESCIRYINLYGLQQQGI
FRVPGSQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDL
ISTIKLENPAERVHQIQQILVTLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMHIPDGQDPVSCQAHINEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEYCDSPH
SEPGTIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYMGRSPRELSFKKGASLLLYHRASED
WWEGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTE
HISDYGFGGGDGPDIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPGPISSEP
ASPLHTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRSS
SSSSSGVGSPAVTPTEKMFPNSSADKSGTM
Download sequence
Identical sequences ENSPANP00000009592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]