SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009595 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009595
Domain Number 1 Region: 251-291
Classification Level Classification E-value
Superfamily CCCH zinc finger 9.42e-17
Family CCCH zinc finger 0.001
Further Details:      
 
Domain Number 2 Region: 223-249
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000105
Family CCCH zinc finger 0.0013
Further Details:      
 
Domain Number 3 Region: 196-220
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000772
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009595   Gene: ENSPANG00000016995   Transcript: ENSPANT00000013273
Sequence length 295
Comment pep:known_by_projection chromosome:PapAnu2.0:13:103022889:103044517:-1 gene:ENSPANG00000016995 transcript:ENSPANT00000013273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFENLFSKPPNPALGKTATDSDERIDDEIDDAEVEEIQEEKIKLEHEQIPKKFRHFGNS
AVSPKSSLHRKSRSKDYDVYSDNDTCGQESEDNFAKELQQYIQAREMANAAQPEESTKKE
GVKDTPQAAKQKNKNLKAGHKNGKQKKMKRKRPGTGNKGSNALLRNSGSQEEDGKPKEKQ
QHLSQAFINQHTVERKGKQICKYFLERKCIKGDQCKFDHDAEIEKKKEMCKFYVQGYCTR
GENCLYLHNEYPCKFYHTGTKCYQGEYCKFSHAPLTPETQELLAKVLDTERKPCK
Download sequence
Identical sequences A0A096NA91
ENSPANP00000009595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]