SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009605 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009605
Domain Number 1 Region: 14-91,135-300
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.71e-65
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0021
Further Details:      
 
Domain Number 2 Region: 342-640
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.03e-42
Family Extended AAA-ATPase domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009605   Gene: ENSPANG00000000596   Transcript: ENSPANT00000009928
Sequence length 719
Comment pep:known_by_projection chromosome:PapAnu2.0:3:41433500:41446138:-1 gene:ENSPANG00000000596 transcript:ENSPANT00000009928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
ELVDSICENARRYAKLFADSVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGTAR
SPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVA
TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFIKFQEMKMQEH
SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
HRIVKMNKSEDDESGAGELSREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPTVPESLADYITAAYVEMRREAWASKDATY
TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
VFATIRELVSGGRSVRFSEAEQRCISRGFTPAQFQVALDEYEELNVWQVNASRTRITFV
Download sequence
Identical sequences A0A096NAA1 A0A2K5N346
XP_011912591.1.92194 ENSPANP00000009605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]