SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009611 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000009611
Domain Number - Region: 129-180
Classification Level Classification E-value
Superfamily L domain-like 0.000663
Family Internalin LRR domain 0.045
Further Details:      
 
Domain Number - Region: 215-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009611   Gene: ENSPANG00000024217   Transcript: ENSPANT00000013807
Sequence length 284
Comment pep:known_by_projection chromosome:PapAnu2.0:13:26248647:26253719:1 gene:ENSPANG00000024217 transcript:ENSPANT00000013807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTSAELREQEKPPASPRANGPGRLGHARGRGPDALRGGAAGPGRVSTGELRERKMAPHG
PGSLTTLVRWAAALLLALGVERALALPEICTQCPGSVQNLSKVALYCKTTRELMLHARCC
LNQKGTILGLDLQNCSLEDPGPNFHQAYTTVIIDLQANPLKGDLANTFHGFTQLQTLILP
QDVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCAD
GFHGYKCMRQGSFSLLMFFGILGSTTLSISILLWGTQRRKAKTS
Download sequence
Identical sequences A0A096NAA7 A0A2K5UI57
ENSPANP00000009611 XP_005576369.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]