SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009620 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009620
Domain Number 1 Region: 136-232
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.0000000000105
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.018
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.000036
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009620   Gene: ENSPANG00000007704   Transcript: ENSPANT00000017153
Sequence length 234
Comment pep:known_by_projection chromosome:PapAnu2.0:3:21010725:21023786:1 gene:ENSPANG00000007704 transcript:ENSPANT00000017153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALTMGVRVLRLWRVASGLGISWRFIATSPASQLSPTELTEMRNDLFNKEKARQLSLTP
RTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFC
YDVVLDSKLDEWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHNK
Download sequence
Identical sequences ENSPANP00000009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]