SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009637 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009637
Domain Number 1 Region: 22-116
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000262
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009637   Gene: ENSPANG00000019261   Transcript: ENSPANT00000000779
Sequence length 149
Comment pep:known_by_projection chromosome:PapAnu2.0:19:2034530:2037237:-1 gene:ENSPANG00000019261 transcript:ENSPANT00000000779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALL
LERCRVIREEPGAFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLVFYRN
EIRKVTGKDPLEQFGISEEARFQLSGLQA
Download sequence
Identical sequences A0A0D9RH31 A0A2K5KP38 A0A2K5WHF9 A0A2K6BV85 H9FWH3
9544.ENSMMUP00000013216 ENSMMUP00000013216 ENSPANP00000009637 NP_001253796.1.72884 XP_005587513.1.63531 XP_007992890.1.81039 XP_011746756.1.29376 XP_011928355.1.92194 ENSMMUP00000013216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]