SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009640 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009640
Domain Number 1 Region: 20-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.27e-68
Family Eukaryotic proteases 0.0000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009640   Gene: ENSPANG00000016242   Transcript: ENSPANT00000017422
Sequence length 254
Comment pep:known_by_projection chromosome:PapAnu2.0:19:273133:278854:1 gene:ENSPANG00000016242 transcript:ENSPANT00000017422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSSMESSLLVLALGALLVGSSFETQIIGGREVIPHSRPYMASLQRGGSHLCGGVLVHPKW
VLTAAHCLVQRTAQLRLVLGLHALGHPGLTFHIKAAIQHPRYKPAPALENDLALLQLDGK
VKPSRTVRPLALPGKRQAVAAGTRCSTAGWGLTQQGGSLSRVLRELDLRVLDTRMCNNSR
FWNGSLSPHAVCLEADSKDQAPCKGDSGGPIVCGKDQVLAGVLSFSSRVCTDIFRPPVAT
AVAPYVSWIRKVTG
Download sequence
Identical sequences ENSPANP00000009640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]