SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009641 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009641
Domain Number 1 Region: 445-852
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.82e-113
Family PIWI domain 0.0061
Further Details:      
 
Domain Number 2 Region: 107-430
Classification Level Classification E-value
Superfamily PAZ domain 7.06e-78
Family PAZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009641   Gene: ENSPANG00000016066   Transcript: ENSPANT00000017401
Sequence length 852
Comment pep:known_by_projection chromosome:PapAnu2.0:14:84301498:84350118:1 gene:ENSPANG00000016066 transcript:ENSPANT00000017401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRARVKARGIARSPSATEVGRTQASPLPTSIDLSNNEASSSNGFLGTSRISTNDKYGI
SSDDAGSTSMERGVKNKQDFMDLSICTREKLAHVRDCKTGSSGIPVKLVTNLFNLDFPQD
WQLYQYHVTYVPDLASRRLRIALLYSHSELSNKAKAFDGAILFLSQKLEEKVTELSSETQ
RGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFYNPSEPVEIPQHKL
SLWPGFAISVSYFESKLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGL
IVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLL
KRKRNDNSEARLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLPPSGRQQRLARLVDN
IQRNTNARFELETWGLHFGSQISLTGRVVPSEKILMQDHICQPVSAADWSKDVRTCKILN
ARSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAVQQYV
DPDVQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMT
CKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPGITRWFSRCILQRTMT
DVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQLKTLVEYEVPQLLSSVAESSS
NTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYLISQVACRGTV
SPTYYNVIYDDNGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKE
PSLELANHLFYL
Download sequence
Identical sequences A0A096NAD3
ENSPANP00000009641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]