SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009737 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000009737
Domain Number - Region: 35-131
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0272
Family BAR domain 0.083
Further Details:      
 
Domain Number - Region: 176-309,351-392
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0759
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009737   Gene: ENSPANG00000012055   Transcript: ENSPANT00000008611
Sequence length 402
Comment pep:known_by_projection chromosome:PapAnu2.0:14:57225431:57249934:-1 gene:ENSPANG00000012055 transcript:ENSPANT00000008611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVALRGASALLVLFLAAFLPPPQCAQDPAMVHYIYQRFRVLEQGLEKCTQATRAYIQEF
QEFSKNISVMLGRCQTYTSEYKSAVGNLALRVERAQREIDYIQYLREADECIESEDKTLA
ETLLQEAEEEKKIRTLLNASCDNMLMSIKSLKIVKKMMDTHGSWMKDAVYNSPKVYLLIG
SRNNTVWEFANIRAFMEDNTKPAPRKQILTLSWQGTGQVIYKGFLFFHNQATSNEIIKYN
LQKRTVEDRMLLPGGVGRALVYQHSPSTYIDLAVDEHGLWAIHSGPGTHSHLVLTKIEPG
TLGVEHSWDTPCRSQDAEASFLLCGVLYVVYRTGGQGPHRITCVYDPLGTISEEDLPNLF
FPKRPRSHSMIHYNPRDKQLYAWNEGNQIIYKLQTKRKLPLK
Download sequence
Identical sequences A0A096NAK7 A0A1D5Q6D5 A0A2K6DME6
XP_011751343.1.29376 XP_014970442.1.72884 ENSPANP00000009737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]