SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009742 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009742
Domain Number 1 Region: 263-380
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.63e-27
Family Calsequestrin 0.0000198
Further Details:      
 
Domain Number 2 Region: 161-260
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-27
Family Calsequestrin 0.00000602
Further Details:      
 
Domain Number 3 Region: 39-160
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.2e-23
Family Calsequestrin 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009742   Gene: ENSPANG00000005566   Transcript: ENSPANT00000016425
Sequence length 387
Comment pep:known_by_projection chromosome:PapAnu2.0:1:134094757:134105318:1 gene:ENSPANG00000005566 transcript:ENSPANT00000016425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATGRMGPRAVPGLRLALLLLLVLGTPKSGVQGEEGLDFPEYDGVDRVINVNAKNYKNV
FKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKK
LGLTEVDSVYVFKGDEVIEYDGEFSADTIVEFLLDVLEDPVELIEGERELQAFENIEDEI
KLIGYFKSKDSEHYKAFEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPV
TIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDKGGASSLGIKGLSEEVWGFGA
ERSITWKKVTITRIYHPLSCRIWISLQLVPYWEKTFDIDLSAPQIGVVNVTDADSVWMEM
DDEEDLPSAEELEDWLEDVLEGEINTE
Download sequence
Identical sequences ENSPANP00000009742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]