SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009744 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009744
Domain Number 1 Region: 180-341
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-34
Family DnaQ-like 3'-5' exonuclease 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009744   Gene: ENSPANG00000019805   Transcript: ENSPANT00000018209
Sequence length 354
Comment pep:known_by_projection chromosome:PapAnu2.0:1:130617570:130621911:-1 gene:ENSPANG00000019805 transcript:ENSPANT00000018209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPPK
KGETPMVDGTWKTPSFPKKKKTAACSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLL
GEFQSALPKISSHPTRSQKKGSQKKSSKKNHPQKNAPQNSTQAHSENKCSRISQKLPQKM
VAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVN
ATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENA
TMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLAQNPPKD
Download sequence
Identical sequences A0A096NAL4 A0A2K5KIT8 A0A2K5XWM4
ENSPANP00000009744 XP_011848199.1.47321 XP_011848200.1.47321 XP_011934132.1.92194 XP_011934133.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]