SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009761 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009761
Domain Number 1 Region: 144-194
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000198
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009761
Domain Number - Region: 12-57
Classification Level Classification E-value
Superfamily RING/U-box 0.0141
Family Zf-UBP 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009761   Gene: ENSPANG00000005449   Transcript: ENSPANT00000024211
Sequence length 313
Comment pep:known_by_projection chromosome:PapAnu2.0:14:29146924:29198779:-1 gene:ENSPANG00000005449 transcript:ENSPANT00000024211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEY
VHGAQACTPPADGEGAGKEEAEVKVEQEREIESEAGDSEEEMEDEQESEAEEDNQEEGES
EAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQ
LSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIA
DEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEVK
EKPIMFSSKRNRR
Download sequence
Identical sequences ENSPANP00000009761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]