SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009778 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009778
Domain Number 1 Region: 162-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.04e-17
Family Complement control module/SCR domain 0.0000511
Further Details:      
 
Domain Number 2 Region: 223-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.51e-16
Family Complement control module/SCR domain 0.0000171
Further Details:      
 
Domain Number 3 Region: 36-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000031
Family Complement control module/SCR domain 0.0000624
Further Details:      
 
Domain Number 4 Region: 97-172
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000135
Family Complement control module/SCR domain 0.0000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009778   Gene: ENSPANG00000001375   Transcript: ENSPANT00000004502
Sequence length 377
Comment pep:known_by_projection chromosome:PapAnu2.0:1:156573527:156610557:-1 gene:ENSPANG00000001375 transcript:ENSPANT00000004502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVARPSVPAALPLLGELPRLLLLLLLCLPAVWADCGPPPAVPNAQPALKGLTSFPENTI
ITYRCDENFTKIPGKHDSVMCLQDSQWSDIEEFCNRSCGAPTRLKFASLKQLYIPQSYFP
VGTVVEYECRPGYRRDPSLLAKLTCLQNLEWSTAAEFCKKKSCPNPGEIPNGQIDISNGI
LFGAAISFSCNTGYKLFGPTSSLCLASDSGVQWSDTLPECREIYCPAPPQIDNGIIQGER
EHYGYRQSITYLCNRGFTMIGEHSIYCTVNDDEGEWSGPPPACRANSLVSKAPPTVQKPT
TVNVRTTEVSPTSQKTTTPNAQATRSTPASRTTKHFHKTTPDKESGTSSGTTHLLSGYTC
FTLTGLLGTLVTMGWLT
Download sequence
Identical sequences ENSPANP00000009778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]