SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009779 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009779
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.15e-16
Family Complement control module/SCR domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 223-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-16
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 3 Region: 155-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000639
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 4 Region: 35-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000863
Family Complement control module/SCR domain 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009779   Gene: ENSPANG00000018540   Transcript: ENSPANT00000006569
Sequence length 392
Comment pep:known_by_projection chromosome:PapAnu2.0:1:156173134:156211109:-1 gene:ENSPANG00000018540 transcript:ENSPANT00000006569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPGRRERPFSSGRFPGLLLATLVLQLSSFSDACEAPPTFEAMELIGKPKPYYKVGERV
DYKCKKGYFYIPPLATHSICDRNHTWLPVSDDGCYREMCPHIQDPVNGEAILVNGSYEFG
SELHFICNEGYYLIGKDILYCELKDTVAIWSGKPPLCEKILCTPPPKIKNGRHTFSEVEV
FEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQIS
GFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKVLPPSSTKSPTLSHS
VSTSPTTKSPTSSASGPRPTYKPPVSNYPGYPKPDEGILNSLDDWVIALIVIVIVVAVAV
ICVALYRFLQGRKKKGTYLTDENHREVKFTSL
Download sequence
Identical sequences A0A096NAP4
ENSPANP00000009779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]