SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009802 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000009802
Domain Number - Region: 47-59,119-186
Classification Level Classification E-value
Superfamily TPR-like 0.0621
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009802   Gene: ENSPANG00000001273   Transcript: ENSPANT00000004164
Sequence length 401
Comment pep:known_by_projection chromosome:PapAnu2.0:2:173369049:173395519:1 gene:ENSPANG00000001273 transcript:ENSPANT00000004164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGRRGVAALLALLCVACALRAGRAQYERYSFRSFPRDELMPLESAYRHALDKYSGEHW
AESVGYLEISLRLHRLLRDSEAFCHRNCSAAPQPEPASGLASYPELRLFGGLLRRAHCLK
RCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEM
MKRNMAYYKSLPGAEDYIKDLETKSYESLFIRAVRAYNGENWRTSITDMELALPDFFKAF
YECLAACEGSREIKDFKDFYLSIADHYIEVLECKIQCEENLTPVIGGYPVEKFVATMYHY
LQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQ
FFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS
Download sequence
Identical sequences A0A096NAQ8 A0A2K5KMI0 A0A2K5UH83 F7DE29
NP_001248681.1.72884 XP_005545586.1.63531 XP_011892345.1.92194 ENSMMUP00000011803 ENSPANP00000009802 9544.ENSMMUP00000011803 ENSMMUP00000038309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]