SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009810 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009810
Domain Number 1 Region: 332-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000921
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 970-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 3 Region: 817-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000248
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 265-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 5 Region: 863-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 6 Region: 506-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 414-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 8 Region: 1080-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 9 Region: 923-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.059
Further Details:      
 
Domain Number 10 Region: 455-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 11 Region: 769-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 12 Region: 1128-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 13 Region: 1038-1077
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Laminin-type module 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009810
Domain Number - Region: 1567-1753
Classification Level Classification E-value
Superfamily Tropomyosin 0.019
Family Tropomyosin 0.022
Further Details:      
 
Domain Number - Region: 104-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.074
Family beta-mannanase CBM 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009810   Gene: ENSPANG00000022685   Transcript: ENSPANT00000008209
Sequence length 1761
Comment pep:known_by_projection chromosome:PapAnu2.0:3:130191174:130298834:-1 gene:ENSPANG00000022685 transcript:ENSPANT00000008209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFQLTLFLHLGWLIYSKAQDDCNRGACHPTTGDLLVGRNTQLTASSTCGLSRAQKYCIL
SYLEGEQKCFICDSRFPYDPYAQPNSHTIENVIVSFEPDREKKWWQSENGLDHVSIRLDL
EALFRFSHLILTFKTFRPAAMLVERSTDYGHTWKVFKYFAKDCATSFPNITSGQAQGVGD
IVCDSKYSDTEPSTGGEVVLKVLDPSFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDTL
LGRRQNDSLDKYYYALYEMVVRGSCFCNGHASECHPMQKVRGDVFSPPGMVHGQCVCQHN
TDGPNCERCKDFFQDAPWRPAADLQDNACRSCSCNSHSSRCHFDMTMYLASGGLSGGVCE
DCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTISGGICVSHSDPALGSVA
GQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNSLGSLPLLTCDVDTGQCLCLSY
VTGAHCEECTVGYWGLGNHLHGCSPCDCDIGGAYSNVCSPKNGQCECRPHVTGRSCSEPA
PGYFFAPLNFYLYEAEEATPLQGLAPLGSETFGQSPAVHIVLREPVPGNPVTWTGPGFAR
VLPGAGLRFAVNNIPFPVDFTIAIRYETQSAADWTVQIVVKPSRGSEHCIPKTSQSKPRS
FALPAATRIMLLPTPICLEPDVQYSIDVYFSQPLERESYTHSHVLVDSLGLIPQINSLEN
FCSKQDLDEYQLHNCVEIASAMGPQVLPGACERLIISMSAKLHDGAVACKCHPQGSVGSS
CSRLGGQCQCKSLVVGRCCDRCSPGSYGLGHHGCHPCHCHPQGSKDTVCDLVTGQCPCHG
EVSGRRCDRCLAGYFGFPSCRSCPCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
NPSSGQPCRPCLCPDDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNP
RISGAPCQPCPCNNNIDVTDPESCSRVTGECLRCFHNTQGANCQLCKPGHYGSALNQTCR
RCSCHASGVSPVECPPGGGACLCDPVTGACPCLPSVTGLACDRCADGYWNLVPGRGCQSC
DCDPRTSQSSHCDQLTGQCPCKLGYGGKRCSECQENYYGDPPGRCIPCDCNRAGTQKPIC
DPDTGMCRCREGVSGQRCDRCARGHSQEFPTCLQCHLCFDQWDHTISSLSKAVQGLMRLA
ANMEDKRETLPVCKADFKGLRENVSEIERILKHPVFPSGKFLKVKDYHDSVRKQIMQLNE
QLKAVYEFQDLKHTIERAKNEADLLLEDLQKEIDLQFSVLNASIVDSSENIKKYYHISSS
AEKKINETSSTINTSANTRNDFLTILNTLTSKGNLSLEKLKQIKIPDIQILNEKVCGDPG
NVPCVVPLPCGGAVCMGQEGHRKCGGAGCHGSLTLSTNALQKAQEAKSVIRNLDKQVRGL
KNQIKNISKLAEVSKNNALQLREKLGNTRNQSDSEEVIEVNSLFIRKVKYFIYEENVPPE
DIEKVANGVLDIHLPIPSQNLTDEVNKILKLMQLCKDYRSDENRLSEEADGAQKLLVKAK
SSAVKAANVLLNLDKTLNQLQQAQITHGRANSTITQLTANITKIKKNVLQAENQTREMKN
ELESAKQRSGLEDGLALLQTKLQRHEDHAVNVKVQAESAQHQAGSLEKEFVELKKQYAML
QHKTSTTGLTKETLGKVKQLKDAAEKLAGDTEDKIRRITDLERKIQDLNLSRQAKADQLR
ILEDQVVAIKNEIIEYATCYS
Download sequence
Identical sequences ENSPANP00000009810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]